SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC41365 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC41365
Domain Number 1 Region: 229-371
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-41
Family Third domain of FERM 0.0000832
Further Details:      
 
Domain Number 2 Region: 127-231
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-37
Family Second domain of FERM 0.0000425
Further Details:      
 
Domain Number 3 Region: 30-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-21
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC41365
Sequence length 459
Comment pep:novel supercontig:GCA_000297895.1:scaffold121:94648:106207:-1 gene:CGI_10025636 transcript:EKC41365 description:"Tyrosine-protein phosphatase non-receptor type 4 "
Sequence
MRLVSAGGTYNVRASEMSSHLQDRQPKMVTCIVHFLDDSQQDFEVDKKAKSQVLLDKVFG
HLELVEKDYFGLQFVDLSPAPDGMISHAHHPVGPYAMRWLDPLKTIKKQCRGPPYEFYFR
VKFYVSDPSKLEEEYTRYHFFLQVKRDILEGRLVTPPSTAALLASFAIQSELGDYNPDEH
KGNYISDYRFIPHQTEDFEKQVSELHKQHRGQTPADAEYHYLDKAKRLEMYGVDLHNARD
QSNIDIQLGVTSVGLVVFQNNVKINTFPWAKIVKISFKRKQFFIQLRREMNDSVENLIGF
NMVSYRSCKNLWKSCVEHHTFFRLYVPNPPSKKIFSMGSKFRYSGKTEFQTLEENKRRAK
IERTFSRSPSKKFARRTVSGHTRDQIIQERNFIDGHRNLPKSQTFGGTPSTARPKSSNSV
NHSFNRYESINNQKRATLPHDYKVGSNSRSSIHSSKSDE
Download sequence
Identical sequences K1RIF7
EKC41365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]