SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|424713819|ref|YP_007014534.1| from Listeria monocytogenes serotype 4b str. LL195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|424713819|ref|YP_007014534.1|
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000445
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|424713819|ref|YP_007014534.1|
Sequence length 251
Comment Putative uncharacterized protein [Listeria monocytogenes serotype 4b str. LL195]
Sequence
MKRMTIWVKNEKNGATEQVIREKEIALGVTLPFEYKQLLSEQNGGLIRKNHFKTTEPTSY
GLDFGEIYYLASLDEILTDIPEQKDVDLAGKQVYFHRDESRYIGFSYIDNTSEPSIIYVD
FETLQTLIVAETFATFIEELYFSPFPTDFAEHFPIKKLNQILASSNVQKTKQLLELLEDY
PDKKWYLATFLGLLEKQEIPYNLVVYRLFENQLLYFRRKLAPELVEQIFVRLEACDGINK
AALAELYKEWK
Download sequence
Identical sequences A0A0B8QPM5 A0A0E1R5J2
gi|424713819|ref|YP_007014534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]