SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|482888433|ref|YP_007885600.1| from Wolbachia endosymbiont of Drosophila simulans wNo

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482888433|ref|YP_007885600.1|
Domain Number 1 Region: 10-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.81e-59
Family NQO2-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482888433|ref|YP_007885600.1|
Sequence length 166
Comment NADH-quinone oxidoreductase subunit E [Wolbachia endosymbiont of Drosophila simulans wNo]
Sequence
MKEKEEEFSFTSDNLKKAKKSIEMYPKGREGSAVMPLLYLIQEQCGWVSESAMRYVADML
HIPHIRVYEVANFYTMYNLKPVGKYLIQVCRTTPCWLCNSEEVLSTFKKKLGINIGETTK
DNLFTLKEVECLGACVNAPVVQINNDFYEHLTPEKVENIIAELSSK
Download sequence
Identical sequences M9WSF1
WP_015587891.1.3462 gi|482888433|ref|YP_007885600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]