SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFQ88177 from Pyrenophora teres f. teres 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ88177
Domain Number 1 Region: 20-275
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-79
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.000000169
Further Details:      
 
Domain Number 2 Region: 365-529
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-45
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.00000113
Further Details:      
 
Domain Number 3 Region: 278-359
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000569
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFQ88177
Sequence length 530
Comment pep:novel supercontig:GCA_000166005.1:GL536568:1365:3126:-1 gene:PTT_16060 transcript:EFQ88177 description:"hypothetical protein"
Sequence
MLFKSSLLAAATLSAPALAAFGVTQTGTNIVVDTGSTATLVFTVDSTNCDIISLKYQGEE
LQDSQASQINSGLGSATVKFEAVGTQYIKITCVAGTLTHYMVAKSGEANIYMATSTTAEP
AVGELRFLARIQNTVLPLEYPFGVVSTTNGETSTVEGADVFLVGSQTRSKFYSSQRFIDD
AVHCVYRDTTPVHACLVMNSYSYETSSGGPFHRDINTNNKPEESSLTFYMNSNHVQIEAL
RQGFHGPYALTFTGSGVPSGGSSFDTTFFKDLSISGYVGPSARGTVTGSATGVASGLQTV
LHWYNNAAQYWAYADGSGKFTSPAMKPGTYTQVLYQGEFKVGASTVSVSAGAATTANIAA
STDKRTTIWKIGDWDGQPKGFRNADKQLRMHPSDARMESWDPLTYTVGTSTLDSVPMAII
QGQNPFTIKFSSTETGATTLRIGTTLAFQGCRPAVVVNTFSPATPAAPTLIDSRGFTRGA
YRGFGEVYDYALPAGTLVDSNSITITCASGSSGTGFLAPNVILDAIELFK
Download sequence
Identical sequences E3S1H0
EFQ88177 XP_003303725.1.2082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]