SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFQ90809 from Pyrenophora teres f. teres 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ90809
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.57e-46
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 370-545
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-35
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000411
Further Details:      
 
Domain Number 3 Region: 281-360
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000687
Family Rhamnogalacturonase B, RhgB, middle domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFQ90809
Sequence length 547
Comment pep:novel supercontig:GCA_000166005.1:GL535069:10897:12644:1 gene:PTT_12520 transcript:EFQ90809 description:"hypothetical protein"
Sequence
MRFLATFTAFLLAPAAVFAAWGYTDDGKNYVIDTGANLVVKVSKTNADMTSIKYRGVEYN
GQNGKNSHVESGLASGTVTIKQYTTPANIIKVTMKVGTLVHTLIFRYGNPNVYIFMNKKD
TSITVSRYILRIPGGIFKNNVNEDTDWVPDGAAVIESGDINGINGQTWSKHYSGKKYGRT
IDYDYVGYTNANVGMYLIRSDHEKASGGPFFRSLIRRGGSGGPDLYDIYHYNMGHTDVMR
FGLQGPSVLHFTDSGAAPNNNLFARRADWGWLDSLEIDGWVPASRRGSVAGVGLANTKSG
FQYVVGLKSAQAQYWTIATGAWRIDKVLPGDYTLTVYKGELEVHTSTVTVTAGGTITRNT
ITCSDPADTAVIWRIGDWDGTPKGFLNFGDTPMKPTYMHPSDSRLAKWDAGNYIIGTSTP
SGFPGYMWKDINNDHLVYFRLTDAQLAKGAKIRIGVTEGMAGGRPSISIGSWNAPLQGDK
GQADTRSLTVGTYRGNNYIYEYNVPASAWVKSAREYQILKISVISGKTSTGYLSPGVSFD
AIDMIGA
Download sequence
Identical sequences E3RTZ1
XP_003301096.1.2082 EFQ90809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]