SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|472406569|ref|YP_007653674.1| from Lactobacillus brevis KB290

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472406569|ref|YP_007653674.1|
Domain Number 1 Region: 314-466
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.06e-20
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 207-302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.82e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472406569|ref|YP_007653674.1|
Sequence length 519
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase 1 [Lactobacillus brevis KB290]
Sequence
MSVPIVILAIIAIVVGVVGGYYLRKSVHERKLDAAKYTAAGVLAEAKKQAETATKEALLE
AKEDSHKYRAEVETELKERRAEVQKQEDRLIQREETLDRKDNSLEKRENSLNRRDKKLSA
EEQNLVKKQQQADSLIEKRQAAVEAVAALSQDDARELIISEAKTALASERAKMIKESEET
ARKTAQANAKDLIVSAIQRSAADMVTETTITVVTLPNDDMKGRIIGREGRNIRTLETLTG
IDLIIDDTPEAVVLSGFDPLRREVAKIALEKLIQDGRIHPARIEEMVAKAKKELDEHVRE
LGEQATFDLGIHSMHPELVKLVGRLNFRISHGQNALAHSIEVAKITGVLAAELGEDVTLA
KRAGLLHDIGRAAEHEDDNSYITTGMELTKKYRESSVVVNAIAAQAEETAAQSVIAELVS
TADIISATRPGARSDSLESYIHRLDKLETIANEFDGVDHSFAIQAGREVRVIVRPDRISD
TDAVVLARDIKQQIEGDLDYPGHVKVSVIREVRSVEYAK
Download sequence
Identical sequences A0A0A7TZZ9 A0A0C1MCJ3 M5ACH2 Q03R31 U2PH96
gi|116333845|ref|YP_795372.1| gi|472406569|ref|YP_007653674.1| WP_011667971.1.1001 WP_011667971.1.10245 WP_011667971.1.12110 WP_011667971.1.12992 WP_011667971.1.14555 WP_011667971.1.30569 WP_011667971.1.33510 WP_011667971.1.34389 WP_011667971.1.35134 WP_011667971.1.35844 WP_011667971.1.41999 WP_011667971.1.47372 WP_011667971.1.49372 WP_011667971.1.51823 WP_011667971.1.56537 WP_011667971.1.57633 WP_011667971.1.61846 WP_011667971.1.6335 WP_011667971.1.67033 WP_011667971.1.68109 WP_011667971.1.79023 WP_011667971.1.80197 WP_011667971.1.85477 WP_011667971.1.86233 WP_011667971.1.86414 WP_011667971.1.92695 LbR43 LcR50 387344.LVIS_1235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]