SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HpaP802440 from Hyaloperonospora arabidopsidis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HpaP802440
Domain Number 1 Region: 257-411
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.26e-21
Family Nuclease 0.059
Further Details:      
 
Domain Number 2 Region: 15-215
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000000011
Family Nuclease 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HpaP802440
Sequence length 489
Comment pep:novel scaffold:HyaAraEmoy2_2.0:scaffold_13:289678:291147:-1 gene:HpaG802440 transcript:HpaT802440 description:""
Sequence
MRTSRDGHNRKGMHLFTTGNRVKLYAASAEYFHDVADDMSHVRHGDLVYLTGWGTCNVPF
KPQHDPSNTKLCDLAEAAVKRGADWRMLVWSNVTERAQNHDVRDLINALPPPKEHGPARF
VYDDRLPYATSSHHQKSVIVRKGRDLVAYVGGVDLTNDRWDTLEHDQAELREQTGIKCLW
NGWLDAHARVEGPATMDVACNFLDRWNSKHEPSQDLLDDLLDFENPAFSKLPPVDKSHTT
HVDIPDDGPHAVQLCRTFSPDYDHYDFAPQGEQSIFHARIKAIRNAQNYIFIQDQYFILV
PELLDAIMDMMPSIERLIVIVQRTVEAGYTGYAKYLYDMVSPIQKAFPDKFKLYTTKEAK
ELYIHSKLVIIDDVYVSLGSANWNRRSMTSDTEIGINIVDTELIKSPENITVNKLARDFR
IQKFMEATKQSYEELNAMTFLQACDALEAAAHDDGSSLIEPYAVEDQAGFDYVPDALRQI
VDPDVERND
Download sequence
Identical sequences M4B838
HpaP802440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]