SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HpaP807932 from Hyaloperonospora arabidopsidis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HpaP807932
Domain Number 1 Region: 10-54,94-188
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000234
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 2 Region: 326-428
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000866
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 751-837
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000366
Family Ypt/Rab-GAP domain of gyp1p 0.023
Further Details:      
 
Domain Number 4 Region: 616-729
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000863
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HpaP807932
Sequence length 958
Comment pep:novel scaffold:HyaAraEmoy2_2.0:scaffold_71:191591:194467:1 gene:HpaG807932 transcript:HpaT807932 description:""
Sequence
MAAVSTQSIPFEMEGVLWTREGRSPLLRGWHKRYFVLSKRSGTLREYVLDADKKQKLLAR
ARRASSGASSTSSASSPNRNHNRSSTSSTNGRTLRRELAVRGSSVKTLPFPLVGKQHAFQ
VTLVSQITSSATWPPCSATATATATATCVAIKVVLSARQADDMRQWITALKTAAMNVVVV
PNRRPSSPIGWNHRNSDETTIETPTPSDVVEVPRPQRADMALLSSVYEWIHEGCVKTSQS
LLVAGVHVPSGSLLVGVNGVMLHTLPPSVVRKLLLESTGPLPVSLRFLRAPAKTGVLCAK
LSSGPLTQFQSLASRYRTSSRKSDWNWTEHVVHLSGTVLTCQVNVATPAVAAVEKSQSRT
LSMKSKSNKTLKRVFLLNSRSSAQSVHDWTAERPFCFTVTVDTHALVFQATSESDRRAWI
DAVRRAIAIAEGVEPGAVAAAARESFDVDTLQLQSAMNMRHVDDQVFADVEGSDGAFFIA
HDDKGGANEAGTNAVPAPPLLPSAEDWTSATKSAAYLPGSELTEMLRILQSSGRFIEALQ
LIQKNTSLRSKYWQQIFQWALDPARALDEKKEGFQQLIGTALSKEYAFSVVSCVCSRDVA
NTVSLCMCVFISFFRDDLQVQKDIPRTAKWLAGSAGAPKLDDDERAVRLESLGRVLHAFL
SSCSLDVRTDENPLSPSSTRLSTSSSPCFYMQGMNGLAFILLEVLESDEIEAFRFLRGII
ARILPHVFGICCDGTGRDHFDLFRSLVEVGDVLQEVVGLHLPCFHAALEQAGLPVCLLAY
KWFPTLFSDVTLTASHSQLRFDTLMCCWDVCLLLGLEGMFCVALALCSAAEDDVLALAGC
GSAVSNSAELVSAAVGRSLALLSPEDLVTNVCEVLELCSHPVMLKLRNAHRRRLKLGYSK
VGNGFATSNNRTSPDRIVKKKPCALLPPIMVTDLDSGKVFKISTSGRMLPSTTATQMK
Download sequence
Identical sequences M4BNE4
HpaP807932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]