SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Hebcy2|32479|gm1.11587_g from Hebeloma cylindrosporum h7 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hebcy2|32479|gm1.11587_g
Domain Number 1 Region: 13-147
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.000000131
Family Fucose-specific lectin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Hebcy2|32479|gm1.11587_g
Sequence length 177
Sequence
MPWKQISGGLSRISAGSVTSVWGVNSNDNIFRYTGDDSKPWIQIPGALTDIGAAADGTVW
GVNAAGDIYRYTWDSTHWIKIPGALKRISAGSRTNVWGVNSAGNIFRYTGDDSKPWVQIP
GALSDIGAGADGTVWGVNSAGNIYRYTGDQGGSQALGPSSRWPHCDLCRHKDQCVGS
Download sequence
Identical sequences A0A0C2XBX8
jgi|Hebcy2|32479|gm1.11587_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]