SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374339208|ref|YP_005095944.1| from Marinitoga piezophila KA3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374339208|ref|YP_005095944.1|
Domain Number 1 Region: 273-535
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.24e-65
Family Tandem AAA-ATPase domain 0.0000000974
Further Details:      
 
Domain Number 2 Region: 100-268
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.54e-42
Family RecG "wedge" domain 0.0000883
Further Details:      
 
Domain Number 3 Region: 468-728
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.49e-42
Family Tandem AAA-ATPase domain 0.00000475
Further Details:      
 
Domain Number 4 Region: 3-94
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0000000017
Family RecG, N-terminal domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374339208|ref|YP_005095944.1|
Sequence length 780
Comment ATP-dependent DNA helicase RecG [Marinitoga piezophila KA3]
Sequence
MNIEDFFNGLEAKLKDALKEKLKWEYLFKELYKYSANYINIIEQEKGLKEKIGSFLGYYK
PIANLSDERRIKRALNGLELIEKLKYEYLIDSPEKPYKDMPLATDIKFIKGVGNKRAKIL
REFGINSIEDTFYFFPRDYEDRREIKRIIDCYHGQNCLVVGNIVNFEEKNIGSLRILSYA
LEDKDGSVLILTWFNQDYIKKFIQVGLKVAAYGTVEVEFGRKTIKNPDFQIITSEQEVQT
GILPVYPLKRGIYQNNMRNIFSETIPYVNYKEEFIPEEIKNKYKLISLSRRIKGIHFPKS
FFHYEKAKEALKYEEIFLFEFSVLMKKRLIKEKIGISKKNEGKLIEEFKKILSFKLTNAQ
NKVFNEIRKDMDSKEPMNRLLQGDVGSGKTVVSEMALLYNYESGFQGAVMVPTSVLAKQQ
FLKIKKHMENFGINVELLLGETKNSEKKIIKEKLKNGEIDILIGTHALIQEDVEFKNLGL
VVIDEQHRFGVKQRLSLINKGVMPDILFMTATPIPRTLAMTLYGDLDVSIIDEMPSGRKK
VKTVYATEEKINEIYKFIEDELKQKHQVFFIYPLIEESEAIDLKAATEMYEVLNKRFKKY
GVELLHGKMKSQEKNDIMERFSKKEFLILVSTTVVEVGVDIPDATVIVIEHAERFGLSQL
HQLRGRVGRSNKQAYCFLVVSKKTTSETRERLRKFAQTTNGFEVSEMDLQWRGPGKFFGT
EQHGLPDFKFPDILSNPELINTARKDANEILSKDPDLIKYPALREEIYKRYGKKLKMLEA
Download sequence
Identical sequences H2J3K2
WP_014295718.1.3510 gi|374339208|ref|YP_005095944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]