SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374340679|ref|YP_005097415.1| from Marinitoga piezophila KA3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374340679|ref|YP_005097415.1|
Domain Number - Region: 87-268
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000837
Family HBL-like 0.052
Further Details:      
 
Domain Number - Region: 50-94
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0118
Family RecG, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374340679|ref|YP_005097415.1|
Sequence length 287
Comment S-layer protein [Marinitoga piezophila KA3]
Sequence
MRKALLVMALVLFGIYSFAFVDVPEDHWAYEYVMDLANRGILPMEDNFNPDVVLTKAEVA
ELLSDTLTYIENDPVLAKAEDIKRVETVMGLLNKKLDDALSVKSDVSKLKGETSRKLLET
KYMVLDLGDRVTSLENALSKNTDDVSVNTENIDGLWEELETLQSDLDYVSGENVKAHEEL
KALIAKKADVEKVKELSEELNKVSTKLETITKVAYRAFNNADMVVEDMLDLSDSVDSLNT
KVSTIEGNVNANTEKINAVEEKANSANTMAMVGIGAAVLAAVLAFVF
Download sequence
Identical sequences H2J5H3
WP_014297188.1.3510 gi|374340679|ref|YP_005097415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]