SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|348026974|ref|YP_004766779.1| from Megasphaera elsdenii DSM 20460

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348026974|ref|YP_004766779.1|
Domain Number 1 Region: 48-248
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000393
Family Galacturonase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|348026974|ref|YP_004766779.1|
Sequence length 267
Comment hypothetical protein MELS_1733 [Megasphaera elsdenii DSM 20460]
Sequence
MMKQFGKTKWTGLLRCTLLTLLLVMMMAPTALGARRTVLVHNVREMMEALGDHTEIILAP
GQYNLSAWLRGPFADPVIHNFAWNPISPPGLYWVYHELELAGFQDLTIRGQDTEAITAEI
VTEDPYSSVFKFLNCQQIRLAHLRFGHIQQEGHCTGAVLNLEQVKDASLDHLDLYGCGTY
GYEARRCKNILLRDSVIRSCTYGLVSATECQNLKIVRTTFKDTSTNLSLFEVNHSRLELL
DCTFQNVLGKINSLDMTEGKVIQIYEI
Download sequence
Identical sequences G0VRR2
gi|348026974|ref|YP_004766779.1| WP_014016679.1.35947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]