SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479193746|ref|YP_007823284.1| from butyrate-producing bacterium SS3/4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479193746|ref|YP_007823284.1|
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.57e-40
Family N-utilization substance G protein NusG, N-terminal domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 98-170
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000000731
Family N-utilization substance G protein NusG, C-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479193746|ref|YP_007823284.1|
Sequence length 171
Comment transcription antitermination protein nusG [butyrate-producing bacterium SS3/4]
Sequence
MSEAQWYVVHTYSGYENKVKVDIEKTIENRGLQDQILEVSVPLEEVIELKNGAQKQVERK
MFPGYVLIHMIMNDDTWYVVRNTRGVTGFVGPGSKPVPLSEEEMMSLGFKAPDVVVDFAV
GDTVVVTAGAWKDTVGVIRTVNESKQSITINVEMFGRETPVELSFSEIKKM
Download sequence
Identical sequences A0A1C5YM14 A0A1Q6JXR2 D7GSL5 R5G2L4
gi|479193746|ref|YP_007823284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]