SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389843433|ref|YP_006345513.1| from Mesotoga prima MesG1.Ag.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389843433|ref|YP_006345513.1|
Domain Number 1 Region: 276-538
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-61
Family Tandem AAA-ATPase domain 0.000000159
Further Details:      
 
Domain Number 2 Region: 105-270
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-37
Family RecG "wedge" domain 0.0000266
Further Details:      
 
Domain Number 3 Region: 478-685
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.84e-37
Family Tandem AAA-ATPase domain 0.0000102
Further Details:      
 
Domain Number 4 Region: 2-93
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.00000000000471
Family RecG, N-terminal domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389843433|ref|YP_006345513.1|
Sequence length 785
Comment ATP-dependent DNA helicase RecG [Mesotoga prima MesG1.Ag.4.2]
Sequence
MLLEQFLEECERLLEAHLSGKREDNVLPELKRFLSLLDRSELSHFSSLGEYLSKFISYLS
RIDEFPHDRKVKRLKNGLEMIAKLRNFFLLHNSEEIESLLGRPVSPSTPIKYAYSVGEAR
SKILKRMDIETIGDLIQYFPRDYEDRRIIMPISSIVPDRKVSVKGRLLNFSAKKASGYTI
ISAVVSDGFGQLLLKWFNQDYIIQKLRRDREYLIHGLAKETPFGPMEMNSPEIEEIQGEV
PREILPVYSLTSGISMKMMRKIVKRNLGLVRSLDDLVPSSITTERGLLPRKHAFTAIHFP
KSLYEIRKARESLAYEEFFLFETTILFRKRQIRKEYQGLQKEISGVLSKRLIESLPFELT
KDQVTAFEEIRDDMRAASPMNRLLQGDVGSGKTLVAELAMVDNYEAGYQSALMVPTSVLA
MQHYEKIKRELSPIGIETGLLTGSLKKNEQDFVRMRLKKGEIDVVVGTHALIQDGVEFKN
LGLVVVDEQHRFGVKQRETLTTKGKLLDSLVMTATPIPRTLALTVYGDLDISTILTLPKG
RSPVRTIILARKRLKDLYSYISDELKMGHQAFFIYPLIEESEQVDLKNATDEATKLREEV
FPGVGVELLHGRLNDNEKQEIMQRFRSRQSMILVSTTVVEVGIDIPTATVMVIEHPERFG
MAQLHQLRGRVGRSNLKSICVMVMNKAISDDALSRLREFASTSSGFDVAELDLRLRGPGE
FLGLRQHGMPQFLIGDIVNDRDLLFKAREDAKQLMEEDPELLEHGALRIEMERVYSERAR
LIEVG
Download sequence
Identical sequences I2F2W7
gi|389843433|ref|YP_006345513.1| WP_014730369.1.93602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]