SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383318546|ref|YP_005379387.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383318546|ref|YP_005379387.1|
Domain Number 1 Region: 14-216
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.47e-18
Family Protein prenyltransferases 0.02
Further Details:      
 
Domain Number 2 Region: 190-274
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000000267
Family Protein prenyltransferases 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383318546|ref|YP_005379387.1|
Sequence length 280
Comment hypothetical protein Mtc_0095 [Methanocella conradii HZ254]
Sequence
MAPSSYDRYINVEALASYILKRRNPDGGFCFYGLDESSLNDAFYAVMVLDLLGRLPTDDR
TVEYVRSFQNDDGGFISVYSAWCTLKALKALGASPRHDPGEYLLQRFRSHRIRDDVYIES
LSIFESSFYLADMLAMTGRRELCKDIAGDVLRYERGDGSFGQPGGSSLMSTYFALAILGL
AGTAPADGEKVANYVRARAVKSGGFSKRPETGLAFMDETYYAVKILEALGEKPDNIRETI
GFIAACQNENGGFRRARASGISGFDTSYYAVESLRALINV
Download sequence
Identical sequences H8I5H4
WP_014404707.1.51978 gi|383318546|ref|YP_005379387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]