SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383319342|ref|YP_005380183.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383319342|ref|YP_005380183.1|
Domain Number 1 Region: 189-442
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 5.49e-122
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000926
Further Details:      
 
Domain Number 2 Region: 2-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.02e-78
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383319342|ref|YP_005380183.1|
Sequence length 443
Comment methyl-coenzyme M reductase subunit beta [Methanocella conradii HZ254]
Sequence
MPKFKDKIDLYDDKGKLLEKDVPLEAVSPVVNPAIRKIVNLTKRSVAVNLEGIETALKTG
KVGGKGRQILGMSLDLPIVKDAEKIAKKVDETIRVSKNDDTEVKVVGGGKYLLVKAPTQR
VEAGAEFVASLSCTASAVTETILDMYKVDMFDAPFVKSAVWGTYPQTMDLVGGNVKMILE
IPQKDEGVGYALRNILTNHCVVIARRNTMNVAALSSIFEQAGIWEMGDAVGPWERYQLLG
FAYQGLNANNLLYNTVKENGKNGTIGSVVATIVGKAIEDKVIKVEKTLPSGYKLYTTDDI
ALWNAYTAVATMAATMVNCGALRGAQAVSSTLLYVNDLIERETGLPGCDFGKVEGTAVGF
SFFSHSIYGGGGPGVFNGNHVVTRHSKGFAIPCVSAACSLDAGTQMFTPEATSGIISVFG
EIPEFREPLIHVAKGAAEVKGKV
Download sequence
Identical sequences H8I4A7
gi|383319342|ref|YP_005380183.1| WP_014405502.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]