SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383319346|ref|YP_005380187.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383319346|ref|YP_005380187.1|
Domain Number 1 Region: 276-554
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.26e-144
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000102
Further Details:      
 
Domain Number 2 Region: 4-275
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.33e-143
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383319346|ref|YP_005380187.1|
Sequence length 555
Comment methyl-coenzyme M reductase subunit alpha [Methanocella conradii HZ254]
Sequence
MSVKETQKRFIKAMKKKFAEEPTSQTTVYKYEGYTQSKRKVEFKKAGDAIAKKRGISAYN
PMVHMGGIPLGQRQLMPYVVSGTDVVCEGDDLHFVNNAAMQQFWDEIRRTVIVGLDTAHA
TLEKRLGKTVTPETISNYLAVLNHAMPGAAVVQEHMVETHPGLTDDCYVKVFTGDDELAD
SIDKQYVIDINKAFPKDRAAQLKKAIGKSLWQAVHIPTIVVRTCDGGTTSRWSAMQIGMS
FIDAYKMCAGEAAVADLAFAAKHASLVEMADILPARRARGPNEPGGLSFGFLADIVQTDR
KYPDDPVKSSLEVVAAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDDFTYYGYDYA
KGKYKMPTKPTMDIVNDLGTEVTLYGIEQYEKYPTTLEDHFGGSQRATVLAAASGVTTAL
ATGSSNAGLSAWYLSMYLHKEAWGRLGFFGYDLQDQCGATNVFSCRSDEGAMCELRGPNY
PNYAMNVGHQGGYAGIAGAAHFGRGDAWTASPLIKVCFADKNLAFDFTEPRKEFARGAIR
EFMPAGERTLVIPAK
Download sequence
Identical sequences H8I4B1
WP_014405506.1.51978 gi|383319346|ref|YP_005380187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]