SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383320072|ref|YP_005380913.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320072|ref|YP_005380913.1|
Domain Number 1 Region: 116-239
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 8.25e-32
Family Reductases 0.014
Further Details:      
 
Domain Number 2 Region: 13-111
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.87e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383320072|ref|YP_005380913.1|
Sequence length 242
Comment flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Methanocella conradii HZ254]
Sequence
MVFEAAAQAIQPIVWETTLDKVIPRTKDVKSFRFKKPEGFRYLAGQWMYINIRIGGVEKM
HHFTMSSSPTEDYIEFTKKITDSEYSQALDRMRPGDWAKLNAPFGEFTYAGESIKIGALT
GGIGITPLRSICRYCVDMRLPADIIMLYSNKTVDDIVFREELEEMQNADSHLTIKHVITR
QPDWKGLKGHIDGTMVKEQIPDYKERVFYICGPPSMNEALKKALKTLDIPDEKIKLEDFT
GY
Download sequence
Identical sequences H8I7Z5
WP_014406226.1.51978 gi|383320072|ref|YP_005380913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]