SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383320075|ref|YP_005380916.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320075|ref|YP_005380916.1|
Domain Number 1 Region: 337-424
Classification Level Classification E-value
Superfamily PKD domain 8.37e-27
Family PKD domain 0.00016
Further Details:      
 
Domain Number 2 Region: 598-686
Classification Level Classification E-value
Superfamily PKD domain 1.05e-25
Family PKD domain 0.00034
Further Details:      
 
Domain Number 3 Region: 1210-1299
Classification Level Classification E-value
Superfamily PKD domain 6.28e-19
Family PKD domain 0.00075
Further Details:      
 
Domain Number 4 Region: 428-510
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000798
Family PKD domain 0.0021
Further Details:      
 
Domain Number 5 Region: 519-587
Classification Level Classification E-value
Superfamily PKD domain 0.000000000144
Family PKD domain 0.006
Further Details:      
 
Domain Number 6 Region: 1325-1380
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000153
Family Type I dockerin domain 0.009
Further Details:      
 
Weak hits

Sequence:  gi|383320075|ref|YP_005380916.1|
Domain Number - Region: 1085-1213
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0293
Family Cellulose-binding domain family III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383320075|ref|YP_005380916.1|
Sequence length 1383
Comment PKD repeat-containing protein [Methanocella conradii HZ254]
Sequence
MVIQSQLNDSVSNVSRGILGLFGDAKVLYCVLTILFIFMISPMTAMADSYVGGIPLTNVQ
NGSVSGGLYVDATPPTWGTQDVIKDFTLPEYTSIQWARLYVSTYCGHMQNNYQGNITTQL
DVNGDGIYDYEWFEDLNVPYSFPGQGGTGPVIINDHLNRVTSDYFMWYDVTSLINSTHLR
VHVLTQKVNPSFDGRVKEIALVVAYNDGSEKVVHYWVNQGHDVASKYAEDSGEIYVGETE
FDAREVSRVGSARLTVAYMSSLNGYYSFPTAGFDQSTQTYQNPLPHGYDVQGDYSGVQTW
DVTNSITGGSIYTLGYHRDLAGSGYAMSFKIPLAFLTIQEPLVMPVADFMANTTIGTVPL
TVQFTDQSTAATSWAWDFDNDGTIDSTEQNPIYTYNNPGTYTVSLTVANKNGTDTETKTA
YVKAQTTELIADFTVDKRLCIGTQTVHFTDLSSGNPIRWEWKIKDPSSASTRLYEQNPSY
LVWRNGYYKVQLTIYNNTSSNTIIKENYIRRVTPIYLDPKVNISEGFNPLTVQFSYHMMQ
TIPDYYYWDFNDDGIIDSTEGYPIYTYTVPGVYHPVVTACKNYDGQWDNFTSDRSLTITV
LDSSPLVAGFSANVTRGLAPLTVRFTDESSGAPTSWAWDFDNDGTIDSTEQNPVYTYAEP
GVYTVNLTISNATMSNSTIKSDYILASSVAPDLSVQSMGYATGYYFANCTTNSLWFVIQN
IGYADAGPFNVTVTLNGINHTVHIDGLAMGATTPAIGTGRLKVQDPTIHVSGEQSEAMVT
VDPDNIIDEADETNNVKAMTKAVINNGYMGKRYSGGSDLLTRRIIDVRGDIIYSIGDSQY
KSGENWWANYTANWTANDLPLPPGSRVVAAYLYLPWCWDKDGFVPESSTMTFNGVTIPYE
AHYTDRKMWGDFDLPYGMFVYNVTGVYNTTENHAVFTKPSDKRISPRGMILYVIYENSNA
TRKKIFMNEEFDMLCGNGDYGSSPEFATSYVPFTGTAIDVAKLAGARLISSPTGAGGEGV
MYFNGHSWYHPWVYMGDSEISVSDVDVSGMLNATGNEMAIRSDGGWIEACNAILVLEYYN
PANVSMLPVSTASAVGNTTEVKIVLDNARSGLAGYSLNVSLVNSSVGEIVGVSYPSWALL
NNTTALPGDSVRISGVDLEGQVGPGASNITLATLTVRGDVPGWTSVLIDGAHLDDDNGSA
VECAPLDGGLTVFTPLMANFTASTTSGTVGPLMPINISFVDLTTGDPGPSSWSWSFGDND
TSALKNPTHAYRAPGRYTVSLAVANEHSSDTKTMAGYIVLKPYVEVFPGYSNMPVDLDDD
GLVEDINGNGRLDFDDVVAYYKSMEWMAGNANVGLSPFDFNHNSRMDFDDVIVLYYELLG
KMG
Download sequence
Identical sequences H8I7Z8
gi|383320075|ref|YP_005380916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]