SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383320600|ref|YP_005381441.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320600|ref|YP_005381441.1|
Domain Number 1 Region: 5-250
Classification Level Classification E-value
Superfamily Aquaporin-like 1.83e-59
Family Aquaporin-like 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383320600|ref|YP_005381441.1|
Sequence length 258
Comment glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Methanocella conradii HZ254]
Sequence
MAEIGLIKRSLAELIGTYALVFLGTGAVVTAALLVQGQAPIAGNSFNVGFGMAEWLAIGL
AFGVAIVIMAYTIGHISGTHINPAVSIALWATGRFPAKDAIAYIVAQLIGASLASLSVAA
IWGMRAVDVGLGATTMGFGVTYWQAILSEAVATFFLMLAVMGTAVDRRAPAGWAGVAIGS
TVAMSIVATGNVTGGSLNPARTFGPYLLDWLMGGANNWSQLPIYVIGPVIGAMVAAFLYS
YIAGLKAEKPASEATAKK
Download sequence
Identical sequences H8I9W3
gi|383320600|ref|YP_005381441.1| WP_014406754.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]