SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383320622|ref|YP_005381463.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320622|ref|YP_005381463.1|
Domain Number 1 Region: 57-225
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.74e-44
Family Tpt1/KptA 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383320622|ref|YP_005381463.1|
Sequence length 227
Comment RNA:NAD 2'-phosphotransferase (Tpt1/KptA family) [Methanocella conradii HZ254]
Sequence
MSIHRSISYSRIKVASMEMKEKVAEVRQCPRHGYFRGTQCKCGNTGRFVLSGFKAEKLGR
IISGALRHFPGELGLSLDEHGWADVKDLEKAIVAKYPWVRGYHIEAMLDTDEKGRYERKG
DKVRARYGHSIEVDLDYPEANFDTLYYGTSEEEADRLLEIGLKPVNQRYVHLSKSIEEAV
KVACIRTEHPVIISVDARKAAESGVRIIDAGPVCLSTTIPPACLKIE
Download sequence
Identical sequences H8I9Y5
gi|383320622|ref|YP_005381463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]