SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383320593|ref|YP_005381434.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320593|ref|YP_005381434.1|
Domain Number 1 Region: 209-313
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000000148
Family mono-SIS domain 0.0018
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily SIS domain 0.000000000162
Family mono-SIS domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383320593|ref|YP_005381434.1|
Sequence length 387
Comment sugar phosphate isomerase [Methanocella conradii HZ254]
Sequence
MSSIDSFYGSVKIQQQFIKQLEEIKKEKILELINLLAGFILDETGRTKVIYGIAEGRSAL
ALYDFLQQSVKYENIYPVTLDDPIRRYIDPGKENLVIAATGSGETKGVLRYLEDAFKLNV
PVVLITANVNSRAYSMVSEYDNGFIFDIEPLKGISNKNLAALGSEFELKLCVLLNAIIPE
LYHHDPGKDADKYYSTLEHIAKNAGLLMDIDPAHLDEWSDKVLNRRGNYVVDGVSRSGFV
ANAFGMRLTHLGRNVFMRDGPTTPAFLRGDAYLPITGSGNTREIIEGAIKAKLRGADIFP
ITVNKSSKLTGLMESWGYTKNIMFVPISQEDMDMYREKEASKILAAKSVQTRPSISELNS
YIFTNAFIALGMDMLGVSEKYLAQKHV
Download sequence
Identical sequences H8I9V6
gi|383320593|ref|YP_005381434.1| WP_014406747.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]