SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340623365|ref|YP_004741818.1| from Methanococcus maripaludis X1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340623365|ref|YP_004741818.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.11e-39
Family CTP-dependent riboflavin kinase-like 0.0000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340623365|ref|YP_004741818.1|
Sequence length 127
Comment riboflavin kinase [Methanococcus maripaludis X1]
Sequence
MEIFGQVVSGLGEGKFFVGLTPYKNKFEELTGFTPFEGTLNVKLKHNFKLDEFNPIEFDG
FEIDGKTYFGGKVLLIKLFNKHGNFINCAVVAPKKTDHSKKTLEIIAPIQLRKFLSLNNS
DVVKLVI
Download sequence
Identical sequences G0H1R8
WP_013998637.1.41672 gi|340623365|ref|YP_004741818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]