SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779168|ref|YP_006543641.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779168|ref|YP_006543641.1|
Domain Number 1 Region: 64-147
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.47e-16
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0059
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000101
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779168|ref|YP_006543641.1|
Sequence length 163
Comment AsnC family transcriptional regulator [Methanoculleus bourgensis MS2]
Sequence
MDEKDLILLQLLEENCRTPVSDLAVMAELSEQDTKDRISRLEAAGVIRRYAAVVDWERAG
NGSVTAVIELKVSPERDFGYDRIAERIARFPQVRSLRLMTGTYDLQLLVTGSSMHEIARF
VAEQIAPMDRIRETATLIIMKTYKENGVTFAVRGEAERLPYSF
Download sequence
Identical sequences I7KX27
WP_014865902.1.51038 gi|397779168|ref|YP_006543641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]