SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779176|ref|YP_006543649.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779176|ref|YP_006543649.1|
Domain Number 1 Region: 44-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.87e-21
Family ArsR-like transcriptional regulators 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397779176|ref|YP_006543649.1|
Sequence length 133
Comment regulatory protein, ArsR [Methanoculleus bourgensis MS2]
Sequence
MVEKNECQEETLPLPPEVEESLCRCGGIAGLTERLPENEVLRRESSLHRALADPIRLKIL
AMLFVQPLCVCVIKAVLGIADSRLSYHLGVLRKAELIAGEAQGNWIIYRLTADGETWAQR
LADTAADKPGERG
Download sequence
Identical sequences I7J6Y2
WP_014865910.1.51038 gi|397779176|ref|YP_006543649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]