SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779238|ref|YP_006543711.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779238|ref|YP_006543711.1|
Domain Number 1 Region: 122-200
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000363
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.014
Further Details:      
 
Domain Number 2 Region: 33-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000107
Family ArsR-like transcriptional regulators 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397779238|ref|YP_006543711.1|
Sequence length 204
Comment Nucleotidyl transferase domain [Methanoculleus bourgensis MS2]
Sequence
MWGIVQHSGHMSKRLDIREDHLRVLSLFTRGYDREMYIREVSRCLPISRGTAQTALEYLE
AKQVLRSVTKGRTRLFSLRRGDHARDFCTLAEVYRRICLREEEPFLAGVLSRIVPHIEGS
GAVFGSHAEGTADEESDLDLFVAGECRGEEIERIGKTYGIRIHLTVYPLEIFDRDLRTDP
FLREVLRNHVLIKGAEYFVEKAVG
Download sequence
Identical sequences I7KX81
gi|397779238|ref|YP_006543711.1| WP_014865972.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]