SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779247|ref|YP_006543720.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779247|ref|YP_006543720.1|
Domain Number 1 Region: 1209-1354
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-28
Family Histidine kinase 0.0026
Further Details:      
 
Domain Number 2 Region: 483-610
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-26
Family PYP-like 0.083
Further Details:      
 
Domain Number 3 Region: 233-364
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-24
Family Flavin-binding PAS domain 0.059
Further Details:      
 
Domain Number 4 Region: 631-743
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.82e-24
Family Heme-binding PAS domain 0.03
Further Details:      
 
Domain Number 5 Region: 876-983
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.71e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 
Domain Number 6 Region: 732-852
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.41e-19
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 7 Region: 969-1132
Classification Level Classification E-value
Superfamily GAF domain-like 1.31e-17
Family GAF domain 0.011
Further Details:      
 
Domain Number 8 Region: 363-484
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-17
Family Flavin-binding PAS domain 0.018
Further Details:      
 
Domain Number 9 Region: 136-245
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000995
Family Heme-binding PAS domain 0.054
Further Details:      
 
Domain Number 10 Region: 18-113
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000803
Family Heme-binding PAS domain 0.045
Further Details:      
 
Weak hits

Sequence:  gi|397779247|ref|YP_006543720.1|
Domain Number - Region: 1134-1207
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00216
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397779247|ref|YP_006543720.1|
Sequence length 1356
Comment multi-sensor signal transduction histidine kinase [Methanoculleus bourgensis MS2]
Sequence
MTPIRPPGTIYEAPPEYRILDGVDDWCLLVGEDHKIVWANPAFRRVLGVPEGDLWQAIHA
LGGDGDLAGRILAALKDEGEAPEFECRIRDLEGGERRCLCSGRKAPSDEGWLLWFREFPD
AGDYEKIVEYTGTATILIEDGGTISVANTEFERLSGYPRREIVGVKRLTDFVPRAEELRR
ITGYHTLRRSDPLAAPKNYSFSFADRSGNIHTVEATIGMIPGTNRSVMSLLDVTGRRRAE
QALQESEERLNLALMAANDGLVDWDLGTGTIFYSPRCFTMLGYEPGEFVPTVSSLLSLVH
PEDRDRVEAALNDMVAEGRDRFEMEFRARSASGRWIYVLDRLQVVSRDADGMPLRIVGTH
SDITERKAAERELLIREMAMESSLSAIAIADLDGYLTYANQALLEMGGLTDPGKILGRHL
AEFWADPGKVGEVLRMLAERGKCSEELTGRRADGTEFTAHVTLNFVTERSGDPVCIMATA
VDVTEQRRMEEALRESEKRYRALAESAPDIIFLVDMEGNALYVNSAGGRLLDREPGALQG
MNVREMFPPRIAERWVAMLRKAAEPAAGSLTEETLLLGDDGGTWLETRLIPMTESDGTVR
NLLGISRDVTRRKRVEEQLQFQALVLGQVDDAVIAVDADGRITYMNRAAERLYGVSSSEA
LGRLNTDFFTYEWLRPDDEEEAQTALQDPGIWRGVTIHRKRDGEALFVDATLSALEDDRG
NATGMLCSLRDITEQKRADLELRIKDMAIASSLGAVALADLEGRIIYVNRASLAVHGWER
EEEVIGKPFSMIWADREEGERTRVEALRNGAWLGEIEAQRCDGTTFPMQLALSVVTDESG
RPLCLMGSGIDIGQRKLAEQDLRIRDMAIASSLNAFTISDLDGRLTYVNQAFLSMWGYTS
AAEVLGRSITEFWQDEEDATDALRALLVSGRYVGERIGRRRDGTAFYVTYSGNLVTNDAG
APICLMASIADITDLKRAEAEIQAHNRKLSVLNQIIGVSTSATDIEEALEDVLAATIALL
DLRGGGIYLVEPGRQSARLVCVRGMPDDFIPPPGVPDIAVPPYADVFVAGEPLFVDDPGE
RDIPPYASIPIVAPGRVVGSLNVVPHDRKQFTDVERSLLVAIGREIGSSIERTMLIRQLE
RAKREANLYLDILSHDIRNAENVSSLYTDLLINMLEGEARGYAQRLRSSIRKSIEILRNV
STIRRIHHESTILVPVDLDQVIQDEIEIFSEVTFQYDRRDLVIMADQLLPEVFTNLIGNA
IKFGGPAVEVTIRVEESGDDVLVSIEDTGPGVPDEMKEAVFMRFGQSRNQKSGQGLGLYI
TRMLITRYGGRIWVDDRVPGHPECGAAFRFTLKRTT
Download sequence
Identical sequences I7LL26
gi|397779247|ref|YP_006543720.1| WP_014865981.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]