SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779296|ref|YP_006543769.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779296|ref|YP_006543769.1|
Domain Number 1 Region: 9-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.79e-25
Family Tandem AAA-ATPase domain 0.089
Further Details:      
 
Domain Number 2 Region: 371-440
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000949
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397779296|ref|YP_006543769.1|
Sequence length 523
Comment ATPase-like protein [Methanoculleus bourgensis MS2]
Sequence
MELAIGKAGDRDITVDAQEVVTGRTCIIAQSGAGKSWGIAVLCEQLLQARIGFCLIDTEG
EYFSLKDRFSLIWIGSGESCDAEIGKTDIREVMHDAIRSRTAVIFDVSEAEDMRDEVAKL
AEILYDLESRLKQPFLLIVEEADKFIPQIGVSIKKIEEISRRGRKRGLGLMVATQRPSLV
AKNVLSQCNSQIIGKLSIENDLKAVSLFFSSRKEVEELAELEPGEFFVMGGLSREKVKMK
FRDRVTKHRGVTPRLVPAPPVPVPESPAAPPEEEVGEDPPAAGDAVIPVLLREEALDIAK
GKRKRRFRILEPEERIVSGERVYRPLLAVEVRYLGGFIRKTTKTASFVLDACTGCIVELD
RGMKVRPGFSELLGLDEAAVKIVAGLANGGSTVAEIEADTHLPPGVVKKAVKQLAQAKLI
TEVKTMGSAVVYVPLLTEEVPGLHALRRGEDLPMEPLREVPLEAKVTESSLRTILKGLEP
TAEIVGLETIYYPVYEIWFASEHGERSIVLDGISGKELPLPVS
Download sequence
Identical sequences I7J743
gi|397779296|ref|YP_006543769.1| WP_014866030.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]