SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779408|ref|YP_006543881.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779408|ref|YP_006543881.1|
Domain Number 1 Region: 435-597
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-37
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 232-354
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000081
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 3 Region: 126-219
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000128
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Domain Number 4 Region: 367-439
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000139
Family Homodimeric domain of signal transducing histidine kinase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779408|ref|YP_006543881.1|
Sequence length 599
Comment sensor histidine kinase ResE [Methanoculleus bourgensis MS2]
Sequence
MAPDPRLHVFFRENLFSETDIVKMIVILSFSAIALMLTANGLESDAYLFSPLLCCIPILF
AVLWFPRHGLQVTALLVAGFALIHLRYVALGFTVDPIVPGLYVVAFFWFFAAMNLFSQHS
HLVVSRYKSLVENARDAKFLCDPETLRLLCASSRFAEILGYAPHELVGIPAEKFWADGTA
KARFIEEMKKEGYIGNMEMIFLARNGDAHAVLLSCRALAPENLFECTVVDTGNLRNERDD
LVQSNGRLRRLIHQSNDIFFMQDTAGRILHFSWMRAPEHNISPDDLIGLGADALLPGDLA
AQHMEWVQKVVDTEKTVQYNLDLEIVGDRHTFSVTIAPMHGGDGSLIGIMGSARDTTEMR
RQRLACRQMAWEIDQWKEFVTTMSHELRTPLQPLIGYLQMVVDDPRYYGLTEEMGMYLTT
CLLCARQEQAVVERMVELSLLAMDHVELTIREVPLHHLVDSVITGSEYDREAQIGNEIPE
DVRIWGDPDRLYPVVESLVSNAVKYNVPPKKVWIRYTESNKNHYIMVCDNGIGIPSDVIE
SIFRPFYIGGADKLNRKGGRIGLGLAIANRYIQLHGGEITVTSVVGEGSTFTIRIPREV
Download sequence
Identical sequences I7KXH5
WP_014866142.1.51038 gi|397779408|ref|YP_006543881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]