SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779448|ref|YP_006543921.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779448|ref|YP_006543921.1|
Domain Number 1 Region: 13-116
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.83e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397779448|ref|YP_006543921.1|
Sequence length 122
Comment anti-sigma factor antagonist btrV [Methanoculleus bourgensis MS2]
Sequence
MQILMANACGISAHTGESGAVISVTGRIDASSAGLLDTELSRLIDGGERAIIVEMGGLEY
ISSSGLRVLLAAKKNLKRSGGDLSIAALTPFVREVFEISGFLRIFSVYESVEEATERKRL
TG
Download sequence
Identical sequences I7KXJ8
WP_014866182.1.51038 gi|397779448|ref|YP_006543921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]