SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779522|ref|YP_006543995.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779522|ref|YP_006543995.1|
Domain Number 1 Region: 150-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000593
Family N-terminal PAS domain of Pas kinase 0.037
Further Details:      
 
Weak hits

Sequence:  gi|397779522|ref|YP_006543995.1|
Domain Number - Region: 277-334
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000471
Family Homodimeric domain of signal transducing histidine kinase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397779522|ref|YP_006543995.1|
Sequence length 353
Comment PAS/PAC sensor protein [Methanoculleus bourgensis MS2]
Sequence
MDLCNHTLTSPLDLLAGICMLHSRGPVVLAVALPEGVAGPLAVLLVELFIAGVALGLLGI
WLKERDVAARIAGMSTGIRAARTGSGVPARLPATGTDPISQFAGEINQVFDELERSRQGL
MESRDRYHHLFESGNDFLLVCAVGREGTPYRILDANALACRSLGYTREELLTVAPQAVIL
IRSDFARDDRRLHSADLIPRQGERIPAEATIHRISLEGTPAVLIIARDVTERRRAEKELM
NYRYHLEELVTQRTGELRIANENLKWQIRERERIEQERMEAYRQIERNIEQFAVLTDHIR
NPLQVIQGMADLIEDERAEKIKEQIGQIKEILRQLDDGWVESEKVREYLERYR
Download sequence
Identical sequences I7LLD8
WP_014866256.1.51038 gi|397779522|ref|YP_006543995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]