SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779690|ref|YP_006544163.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779690|ref|YP_006544163.1|
Domain Number 1 Region: 326-427
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.54e-16
Family N-terminal PAS domain of Pas kinase 0.059
Further Details:      
 
Domain Number 2 Region: 134-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000274
Family Heme-binding PAS domain 0.033
Further Details:      
 
Domain Number 3 Region: 37-146
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000227
Family Heme-binding PAS domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779690|ref|YP_006544163.1|
Sequence length 429
Comment sensor histidine kinase [Methanoculleus bourgensis MS2]
Sequence
MMRNNNIRRTGGNAPGTDGREFSGREICLSLLREAPDGFVLVDSEERCRCLNRAFTRITG
YTGDDLPTVAAWFERAHPNPAYRRGVQEMWQELLQGDRSAVVAGVVCRDGKVRDIEIRQT
PVEGGCSLYVVRDVTDQVAIEEHLRQATSELTAVIEALPDLFLRLNADGTIIESRAGRLV
EVSLVPRALLGRRVQDLLPAELGEAVGNALQQAVRTGTPAAPLEFSHQEDGEVRHYEARI
VPLYEMHVMAVIRDITERKRAEQELHRHREHLEDLVAGRTDELERANQQLQRLLHYIEMT
ERRAAEEWLDLSAGQGSLGTAEPEEGRITTDAAGTVVIVNRAAERLTGYTGGDLTGRPIW
PLLSITGTDGDAREFLSRELLEQGRAIQRAEGMALVRSDGTELSIHFSGDPIIDADGAVI
GMVCTFQRV
Download sequence
Identical sequences I7LIY9
WP_014866424.1.51038 gi|397779690|ref|YP_006544163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]