SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779770|ref|YP_006544243.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779770|ref|YP_006544243.1|
Domain Number 1 Region: 64-126
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 1.44e-17
Family Iron-dependent repressor protein, dimerization domain 0.0018
Further Details:      
 
Domain Number 2 Region: 140-207
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000000000224
Family FeoA-like 0.0074
Further Details:      
 
Domain Number 3 Region: 3-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000156
Family Transcription factor MotA, activation domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779770|ref|YP_006544243.1|
Sequence length 210
Comment HTH-type transcriptional regulator [Methanoculleus bourgensis MS2]
Sequence
MLPSTFEDYLEAILTITENGRQQATSQEIAAALGTGRAAAGETIASLVEEGYLEQAPGDA
VRLTGKGRTVASKVARKHRVLQCFLTEALGIEEDAANREACTLEHGISDETIDRLSSYMD
GAQPPPGRLGRCWGRDACTLLDCKEGDTVRVAMLRGPRRNRRLLDLGIFPGEVVQIRRKL
PNQSVVVRVKGCDIAISPEIAASIIVESCP
Download sequence
Identical sequences I7LJ11
WP_014866504.1.51038 gi|397779770|ref|YP_006544243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]