SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779780|ref|YP_006544253.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779780|ref|YP_006544253.1|
Domain Number 1 Region: 341-473
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.47e-26
Family Histidine kinase 0.0028
Further Details:      
 
Domain Number 2 Region: 152-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000227
Family Heme-binding PAS domain 0.049
Further Details:      
 
Domain Number 3 Region: 13-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000192
Family PYP-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779780|ref|YP_006544253.1|
Sequence length 489
Comment Aerobic respiration control sensor protein arcB [Methanoculleus bourgensis MS2]
Sequence
MNQQKIRETMNRSQVPMSIFDHLQQPALVLDREGRVVIWNDSIAQYTGVAAEEILGKGGY
AHAKALFGERRPTLADCVLTHSNPGSDYYRLLAHDGEELLAESRIPLVSGRRVACMAAPL
YDPAGRLIGAVETIRDAPGERSVNESAGVPEDEVQVLAKSLPDMIFTLNRDGVFLRFLWT
GGQEMGLDTAEITGRTPRTLFPEEEADFLSRAARQVIETGEAVSESRSFLWHDEQRSFQI
TIHPLHDAAGEIVAATGVARDITRELLCERTLQETSRFSSLYLDLLGTDIYNTSMVAATI
IEMLRERLSGEEAELAQRVKNTIEQGINVIKNVELLNTLNKHHIRLEPVDLDGVIRGQIQ
RYAGIDIRYEGGSCMVWANPLLEHVISNLISNSIKFGGMKVRIDIRVMETGDIVTLSVTD
TGIGIPDHLKLNVFDRFSQGSKSASGSRGLGLHIVKTLTNRYGGRVWAADRVPGRPEEGA
AIKVILQKC
Download sequence
Identical sequences I7LJ15
gi|397779780|ref|YP_006544253.1| WP_014866514.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]