SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779787|ref|YP_006544260.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779787|ref|YP_006544260.1|
Domain Number 1 Region: 146-257
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.31e-22
Family FHA domain 0.0025
Further Details:      
 
Domain Number 2 Region: 17-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000343
Family PF1790-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397779787|ref|YP_006544260.1|
Sequence length 267
Comment FHA domain-containing protein [Methanoculleus bourgensis MS2]
Sequence
MTGDDDSRTLILDIDSDDLQELSEYLDVLSSSTRLKILKVIERTPKDVRQISSEIETSYE
NTKKHLDKLLSIGVVRKEAGLSRPTSKGIHPVWKYSLVPGGLEAITRSLGLFANLKLTLT
DAVLAKKLAGVRETFSGEFFGQRPVVILLGGVEDGKVFPIEHDTIAIGRVDPDAPGRSDP
KRDIILSEEYAAVTRVSRPHARITRRADARFIEDSGSTGGTFVNGTPLDRGKRRELHDGD
LIELAKGAPGATLVFVVPGGVPPSDAA
Download sequence
Identical sequences I7LLQ0
gi|397779787|ref|YP_006544260.1| WP_014866521.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]