SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779827|ref|YP_006544300.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779827|ref|YP_006544300.1|
Domain Number 1 Region: 93-378
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.89e-64
Family Tandem AAA-ATPase domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 433-546
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-29
Family RecQ helicase DNA-binding domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 559-631
Classification Level Classification E-value
Superfamily HRDC-like 1.4e-24
Family HRDC domain from helicases 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397779827|ref|YP_006544300.1|
Sequence length 780
Comment ATP-dependent DNA helicase RecQ [Methanoculleus bourgensis MS2]
Sequence
MVESTGRPAQFPQRFPAIACRRTFTRVITPGREPTLLMDPLYAALEHYYGYTSFLPFQEE
IVRDILRKRDVLAVLATGGGKSLCYQLPALVTGGLTVVVSPLISLMKDQVDTLVTQGVPA
ATLNSTLPYDAMVKTLADLEAGRLRLLYVSPERVVQPRFLAALRESGVTLVAVDEAHCIS
EWGHQFRPEYRQLSVLKEQFPEVPMIALTATAIPEVRQDIIRQLSLADPAVYVGSSNREN
LRYTVAGKKDAYPQLIDYLRSNPNRSGIVYFSSKKRTEEIAERLRNDGVRALPYHADLPD
NYRHRVQEQFIRDEIDVVCATNAFGMGIDKPDVRFVIHYDMPKSLEAYAQETGRAGRDGE
ASDCILFYSPGDRRKNQVMLERDSLDRPDLYPVAVQKLNDMAAFCETTRCRREYLLRYFG
ETFTGVPCGGCDICLQPDEFIDGREIAEKIVRCISGLPGPFGITHIADILAGSKSSRVLA
RGHQDLPSYNSGSEYSSNQWSSFIRQLIATGYLDQSSGKYPVVTLNVRSRAVLSGGESVR
LARPEDSRARDRGNGPDERPFDAELFEELRSVRKRLADDLSVPPYVVFHDRTLKEMARRY
PQTLEEFAAIPGVGSAKLERFGEIFVAAIGNCRPPVPDAGGAAARPGGEPGGSLPSAQPV
APADPDKIPDDLLLEEAYALQGYIRELREELRRAEDLHKALLARARETGIRENEAYALAT
EISRRRHIVTERFYERYPEVFVKIAKVTISAAEQAVGKEALEECVEYEESEKVSVRNKAA
Download sequence
Identical sequences I7LLR5
WP_014866561.1.51038 WP_014866561.1.63524 gi|397779827|ref|YP_006544300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]