SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779831|ref|YP_006544304.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397779831|ref|YP_006544304.1|
Domain Number - Region: 240-272
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00431
Family MarR-like transcriptional regulators 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779831|ref|YP_006544304.1|
Sequence length 283
Comment hypothetical protein BN140_0665 [Methanoculleus bourgensis MS2]
Sequence
MNNQLLTGGLRDVVHIIPLGHEIDRAVAPFTKNKADRAYILAIPPDGGLDPGMVKKQHYF
VGRVTGRLQELGIAVTFVPVAMFDILDVLKGVSFLIRTEKEAGNAVYVNMSSCGRKTSVA
VTLAAMVHEVPLYYVSADRYATGGGEEECEHGLSIVENVRTEVFQRFRIMMPKPENVMLL
VELLRRKESGGDGMTSEEIIGFFHSIGVHGYEEEKLHTAERDAYQRAKKKRALLNRMNRG
YLRELEEQGYVERQWQGRNFSVQVTKAGEHIACVSGLIPGSGV
Download sequence
Identical sequences I7J7P7
WP_014866565.1.51038 gi|397779831|ref|YP_006544304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]