SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779837|ref|YP_006544310.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397779837|ref|YP_006544310.1|
Domain Number - Region: 34-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00788
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397779837|ref|YP_006544310.1|
Sequence length 166
Comment hypothetical protein BN140_0671 [Methanoculleus bourgensis MS2]
Sequence
MSGKKLPKLPEELEEYLNKPYGGLFGNTVLAQVVEEIIADPTMDYRPRYLEEMTGKRPPS
IREALKTLVRLGLIENISSDVQHPVYRVVVESKKFVALSLLAYAVIDDRDGTDCMDTAIQ
DYYNSSLRAKVEPLAIAMNYTGKWTIGGEYSERDTDSGYVTFAAGA
Download sequence
Identical sequences A0A162VDI8 I7LLR9
gi|397779837|ref|YP_006544310.1| WP_014866571.1.51038 WP_014866571.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]