SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779896|ref|YP_006544369.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779896|ref|YP_006544369.1|
Domain Number 1 Region: 85-269
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.3e-51
Family Mismatch glycosylase 0.00037
Further Details:      
 
Weak hits

Sequence:  gi|397779896|ref|YP_006544369.1|
Domain Number - Region: 296-340
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000119
Family Transcription factor E/IIe-alpha, N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779896|ref|YP_006544369.1|
Sequence length 348
Comment A/G-specific adenine glycosylase [Methanoculleus bourgensis MS2]
Sequence
MVGWHKNVGAGLTAPVPARVRARHCRLSRGCGHVDPSVAGARPNLFHPSDRIIGVIGTLD
PRQNERERQLLEEIREQGNTPKAARLFQDLILSHYRAYGRDLPWRRTTDPYHILVSEIML
QQTQVERVVVRYHEFLERFPDFESLARAPQSEVLLAWQGMGYNRRAISLQKTARLVVDEY
GGNLPADVETLATFPGIGQATAAAICAYAFNMPVVYIETNIRRTFIHFFFQDQKGVRDDE
ILPLVEQTLYLENPREWYSALMDYGTVLKKRTVNPNRRSASYTRQSRFEGSDRQVRGKIL
ALVLEEGTVTEEEVAARVSEDAERVKRILGDLEKEGFIAESEGTYSCR
Download sequence
Identical sequences I7J7S4
gi|397779896|ref|YP_006544369.1| WP_014866630.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]