SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397779947|ref|YP_006544420.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397779947|ref|YP_006544420.1|
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-17
Family PF1790-like 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|397779947|ref|YP_006544420.1|
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000296
Family TrmB-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397779947|ref|YP_006544420.1|
Sequence length 207
Comment ArsR family transcriptional regulator [Methanoculleus bourgensis MS2]
Sequence
MLEGGEVSRLLDILGNRNRRRIIELLRQKPCFVTEISERLVLSPKAVIDHLQMMEREHLL
ISCQDERRRKYYYLSHDINVIVNLQKQDRVTLPTVDEDQKTRFARNLTVFRRMVRARDEL
LDNLEQLERDIESRFVEVMRTGEDFITGDGDLEILLALSHFDLTLAELEEMCSLSTDELK
QRLNNLMYTGVVERTNDRYQIRGTHGE
Download sequence
Identical sequences I7LLW1
WP_014866681.1.51038 gi|397779947|ref|YP_006544420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]