SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780137|ref|YP_006544610.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780137|ref|YP_006544610.1|
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily CheY-like 2.99e-32
Family CheY-related 0.0026
Further Details:      
 
Domain Number 2 Region: 587-707
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-21
Family Histidine kinase 0.0028
Further Details:      
 
Domain Number 3 Region: 141-250
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.54e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.049
Further Details:      
 
Domain Number 4 Region: 371-493
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.31e-16
Family Heme-binding PAS domain 0.059
Further Details:      
 
Domain Number 5 Region: 245-371
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.26e-16
Family PYP-like 0.092
Further Details:      
 
Weak hits

Sequence:  gi|397780137|ref|YP_006544610.1|
Domain Number - Region: 497-562
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000137
Family Homodimeric domain of signal transducing histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780137|ref|YP_006544610.1|
Sequence length 726
Comment multi-sensor signal transduction histidine kinase [Methanoculleus bourgensis MS2]
Sequence
MNDLLVVDDEPDWLALVKLFLGQMGEFRVDTRTSATDGLAALGQHQYDAVISDYEMPGMN
GIEFLRAVRSGFGRIPFIVLTGKGREEVVIDALNNGADYYLQKGGDPRALFAELAHVVGR
SIQLKNAGETLYEREQRYHDLQNANDLIQSVALDGHFIYVNNRWLETLGYREQDVADLNV
FDIVHPDSLPHCREIFQRLISGENVGIIEVVFKTSEGRKVFVEGMATCRMNGGAPQSTRG
IYRDVTRRKVAEQKLAEAEEFNRRIVESCQECIKVLDLDGNLLSMNSYGQQQIGVTDITP
YIGTSFLHFWQEVSPEKVSETLEAARQNRRGQFEALCTAVTGESKYWDVVITPICDARGI
PERLLATSRDIDERKRAEEVLRRSERELKVLLDSLPTGVVIVDAATHLITDANATALALF
DAPRGMVIGRHCHNYICPATEGDCPITDRGNTIDRSERIAVTAHGEEIPVLKSVAKMHLS
GRECLVESFMDISDRKRAEEALMRANRQLNMMASITRHDILNKVTVLLGYIALLRERVND
PGVAQYLDILESTTNIIQSQIEFSRRFQEIGAQEPRWLLVSDLLPYLHLPPGVRMLTDLS
GVEILADPLLEKVFFNLLDNSVRHGGSVTSIRVYSTGGPDDTKIVWEDNGTGIPDEEKER
IFRRGYGKNTGFGLFLVREVLSITGMTITETGSFGTGARFEICVPPEKVRIRGPAAPSPS
AGTGDR
Download sequence
Identical sequences I7LM33
gi|397780137|ref|YP_006544610.1| WP_014866870.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]