SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780197|ref|YP_006544670.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397780197|ref|YP_006544670.1|
Domain Number - Region: 379-457
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0113
Family Z-DNA binding domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780197|ref|YP_006544670.1|
Sequence length 462
Comment ATP-dependent DNA helicase RecG [Methanoculleus bourgensis MS2]
Sequence
MYYQQSTVSTMIESQNVEFKESWKDECLKTLCAFANTSGGVLKLGIDDAGRPVGIHQVKR
LLRELPNKIRNKLSITPSVVAETVAGKEIISITVSPSPVPVSCDGRYYRRSGSNTFDLAG
QELVHFLISKSGITWDTVTGDYSIDDIDPGVVRMFVRLAKRSNRLDTADEEEPVDSILRR
LELTVNGKLTNAAIMLFGREPQRFFVNTTTRVGRFKGGDIIIGDEEFSGNLIQQFMRAEE
RVKSFIDVRYEISADAMQESFQRKEIWDYPLLAIREALLNALIHRDYFNTDIQTQIRIYD
DAIRFHNPGSLPQGITIEMLKTEHYSFLRNPLIAKIFYLAGFVERYGSGIGRIVDALAEA
GLPEPEFQSDSFGFIVRMRKDLRFTESSLRAIGLNERQLQAMSFAREHGAITAVDYASIA
PGVSEKTRYRDLLDLVHRGLLEAVGARRGRKYVLARLPPWNA
Download sequence
Identical sequences I7LM59
gi|397780197|ref|YP_006544670.1| WP_014866930.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]