SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780354|ref|YP_006544827.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780354|ref|YP_006544827.1|
Domain Number 1 Region: 41-246
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.66e-28
Family MoCo biosynthesis proteins 0.013
Further Details:      
 
Domain Number 2 Region: 277-327
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000246
Family ArsR-like transcriptional regulators 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780354|ref|YP_006544827.1|
Sequence length 329
Comment radical SAM domain protein [Methanoculleus bourgensis MS2]
Sequence
MRGSCLRLNAEDLSRPDNTMAYRYLFGPVCSRRLGTSLGVDLVPLKTCTFNCVYCECGQT
TSLTRERREYVPTDRVLAEVDEYLAKAPNLDYVTFAGSGEPTLHSGIGEIISFIKDRYPR
YRVAVLTNSALLTDPDVRAALMQADLIVPSLDAVSEEVFQEINRPCPGLTAGQVLAGLET
FAREFTGEIWLEVFIVPGLNDMEEEILRLRDAIAAIDPDCVQVNTLDRPGTEVWVRPAPP
LALERIASMLGGNAEVIGAVCMGRALPPKAGEVIDLLLATIRRRPCTIGDLAGILGLRPA
EVSKCLRVLEAEGRVEPVREKRGVFYRAI
Download sequence
Identical sequences WP_014867087.1.51038 gi|397780354|ref|YP_006544827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]