SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780388|ref|YP_006544861.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780388|ref|YP_006544861.1|
Domain Number 1 Region: 447-577
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.86e-20
Family Histidine kinase 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|397780388|ref|YP_006544861.1|
Domain Number - Region: 289-352
Classification Level Classification E-value
Superfamily GAF domain-like 0.000133
Family GAF domain 0.01
Further Details:      
 
Domain Number - Region: 360-430
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00275
Family Homodimeric domain of signal transducing histidine kinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780388|ref|YP_006544861.1|
Sequence length 588
Comment multi-sensor signal transduction histidine kinase [Methanoculleus bourgensis MS2]
Sequence
MTGKFGVLYCENLAREMAAVVATGEFLEILTEPFRMDCGGRRAGWDRFVIGHSRFQESCE
KVCVLGCGCLKWIEPPGPAVVIPDLMREVLLPVPLYDACVREGAFMVIPGMLSRWSEYLA
GLGFEGEAAGEFCRESIRKIVLLDTGIDPEASRNLAALGDDLGIPIERIPVGIEPLQRYL
ALQYLQWRLEQEKKTYRDSIAAANQRSADYAMTIDILGRITELQSEETVAEEMLDLVTVL
FAPARIGFASIDGGEAGRIISRPPGYYDAPGRAAEFFAPETRNAILSDRDGLSMEVRHKN
QCVGVLVLEGLAVPHRAAEYLSISRSVTEVCGLAIANARTYQKLQEAVMERDREIGERMR
AEKALREANRKLNTLSSITRHDILNQLAALLGYLEITQMDLESGRLPADPTLVRYVANEL
QAARTIQRQVEFTRFYQDIGVKEAEWHDAETLIRQAAEELPLSEVRVDIGVTGLWVYADP
LIGKVFYNLMENSVRHGGDISRISFLGSRAEGGLVITYTDDGRGIPAADKERIFRKGFGK
NTGLGLFLTREILAITGITINETGVEGEGVRFEIFIPEGEYRLVGSDT
Download sequence
Identical sequences I7KZ83
gi|397780388|ref|YP_006544861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]