SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780441|ref|YP_006544914.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780441|ref|YP_006544914.1|
Domain Number 1 Region: 613-647,680-949
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 6.54e-64
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 82-197
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000593
Family Heme-binding PAS domain 0.069
Further Details:      
 
Domain Number 3 Region: 195-319
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000611
Family Heme-binding PAS domain 0.059
Further Details:      
 
Domain Number 4 Region: 324-443
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000558
Family Flavin-binding PAS domain 0.058
Further Details:      
 
Domain Number 5 Region: 447-566
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000113
Family Flavin-binding PAS domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780441|ref|YP_006544914.1|
Sequence length 951
Comment Sensory rhodopsin II transducer [Methanoculleus bourgensis MS2]
Sequence
MIDKPGRKALFTGPVVPGTTGQGPVVLPEAVEAALNAGIDGDTSVRIDLAGVPEGFRPLA
VSINALIEKNEEEKRSLQSQLEAAGALRQRSETIIQQNPMPILVVDTGLGVTMANAAYAD
MSGIPRDQVVGRSLRDFRVTSQKGSGLRQVIREKKQAYAEVVVELPSGTHTLEQYGIPLL
DAKDEIESILIVYNDITRQREGEEEIRAQMENIAELQRQSETIVQKNPMPILVVDTGMKI
VTANEAYLRLTGIDRSRITTMTLRDFKILDQKGEGLRKVLTEKEQVYGEVTVEFPAGTYI
LEQYGIPLLDEKNELTGILNVYNDVTEKRKEEAEIRRMQHRIDTMIRENPLAIATLRPDK
SRIDINDEYARMWRGTREETLAKKLYDYDITILDGDHFYACYETKKLARTDVMVKWPDGV
KKYLTLNAIPILDEKGDIEMAFYVWNDWTDLQEEREEVAKTEHRVDAMIKQNPLAIATLR
PDKSRIDINDEYARMWRGTREETLAKKLYDYDITILEGDHFYACYETKKLARTDVMVKWP
DGVKKYLTLNAIPILDEKGDIEMAFYVWNDWTGQQEKEDQIRDLMETARRESERLAESAK
ELGGALAAMAKGDMTAFVEAEGDDPLHVVKSDYNASLTAIRAFLNEVAKAVHRVEETAKE
VSKSSDEIIRATEQVAVSTQQSSEDARKQLVGIEEIGKDINDLSASIEEIASTSQEVMEH
ASRASKEGNEAASLGEVATKKMLLVEEISKQTVDEISTLNEQMREINNIVKLITDIANQT
NLLALNAAIEAARAGEHGRGFAVVAGEIRNLAGESKRASQDIEDLIRTIQASTEKTAGSM
QASHQEIQAGIESVNKVIGALNRIVNGVEVVAHGITEITKATEDQAGSTNNVMQKMDEST
HMTKENLDRTEDMAALAEEVSASTQEVGSASHELAGMAEQLEKLMREFKLS
Download sequence
Identical sequences I7J8N2
WP_014867174.1.51038 gi|397780441|ref|YP_006544914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]