SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780471|ref|YP_006544944.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780471|ref|YP_006544944.1|
Domain Number 1 Region: 3-214
Classification Level Classification E-value
Superfamily PhoU-like 6.7e-57
Family PhoU-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780471|ref|YP_006544944.1|
Sequence length 216
Comment Phosphate transport system protein phoU [Methanoculleus bourgensis MS2]
Sequence
MVNKYREELRELKDMVQEQGVFAYGMLSSAMTALQDQDPELARQVHARRVELAERNLTIE
EAALRLIALYQPMARDLRSIVCALRMNVALFRIGRYGKDIANLVEGLSEKPHIGNLMNLP
HMADLVCAMIDDALKAYRTEDIVLIEGMSRRDDVVDDLRYAIFRESVTYMMEDPKNITRC
MDYVMVARYLERCGDYACDIAEQVCYMVTGERVEVK
Download sequence
Identical sequences I7J8P5
WP_014867204.1.51038 gi|397780471|ref|YP_006544944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]