SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780481|ref|YP_006544954.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780481|ref|YP_006544954.1|
Domain Number 1 Region: 307-438
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-23
Family Histidine kinase 0.0029
Further Details:      
 
Domain Number 2 Region: 108-222
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000419
Family N-terminal PAS domain of Pas kinase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397780481|ref|YP_006544954.1|
Sequence length 444
Comment Alginate biosynthesis sensor protein kinB [Methanoculleus bourgensis MS2]
Sequence
MPGKRRSVGGNTRLLLVAASVIVAFAANAAGLFFGITSVLPHLFYLPIVLVAYWFPRRGT
ASSLALSLGYLAMTLPFARGDAGLAVAALARAVVFVAIGAVVSLLSLRLREQEQRYRGVF
DNSEAGTFIVAPENAGPRIEEVNYVGAALLGSTAKDLIGEPITRFLDDPGAWRDFQVKVR
PDKAVYGYETALRRPDGVAVQVIVSGGRLPDGRIILTLVDITARKSAEDALRQANTKLNM
MGRLTRNDLMSAVSGLLRRISEGMGEFDDPAVRRYLESLEEDARFVQRRAEITRDYQDLG
LRPPGWQPLQEVIREVTSCLLLPGVSVRSWVERLEVFADPMLDRVYVNLIENSARHGETV
SEVVITYQLRDDGLVIYVEDDGVGVPEAEKEKIFEYRVDGGGGLGLFLVREILSITGMTI
QETGRPGEGARFEIHVPPDGYRLI
Download sequence
Identical sequences I7J8P8
gi|397780481|ref|YP_006544954.1| WP_014867214.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]