SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780487|ref|YP_006544960.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780487|ref|YP_006544960.1|
Domain Number 1 Region: 13-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000468
Family PF1790-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780487|ref|YP_006544960.1|
Sequence length 126
Comment hypothetical protein BN140_1321 [Methanoculleus bourgensis MS2]
Sequence
MRSDKVRYFTPRDEELAELLMGIGIKRNVSKVLVYLANTDEATSRDIERGTDLRQPEVSI
AMRYLRECDWVDTRESKSESKGRPVKIYTLSRPITEIMDTIEKEKRKEARHQLDLIQKMR
ECISMQ
Download sequence
Identical sequences A0A0X3BMQ2 A0A162YS10 I7LMH2
gi|397780487|ref|YP_006544960.1| WP_014867220.1.51038 WP_014867220.1.63524 WP_014867220.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]