SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780576|ref|YP_006545049.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397780576|ref|YP_006545049.1|
Domain Number - Region: 54-158
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.09
Family Cellulose-binding domain family III 0.062
Further Details:      
 
Domain Number - Region: 178-251
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0963
Family Cellulose-binding domain family III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780576|ref|YP_006545049.1|
Sequence length 421
Comment hypothetical protein BN140_1410 [Methanoculleus bourgensis MS2]
Sequence
MIRNPGAAPRQGMGRRTIDCIAGVLIVILVLIPAAAAAPTVIVSNYTVTPAVLMPGDEGT
ITVVLTSTASAATGSALNVRVDSGGVNASPETPGNAYIENVLLNSKEVEVLSGSYQDVGE
IGPGQSFPLTFRIRAPGEEGIYFPEVWVRVRGATGVKYPIPVNVNSAYALIKKPALRVER
TVPASVDPGESFNVTLTLYNEGQASASDVSVNINASSRAITPKTSENYYIPKLEPGEESV
LSMMFETDINAPLGLQPVFVTIEYQNAARSMFRQVETVGIPIVGRAEMGVASIRTEPTRI
TAGDQVDLTIRIENTGTADAKSVRATIDDLDLSGTKEAFLGTIEPGNDGPAVFSLQTDRE
GEFPYTLTIQYTDDYGAHTTRQPLNLVVAGPDAVPAIAIAAAILTAVIVAAAFWYRRRKR
E
Download sequence
Identical sequences I7J8V6
WP_014867309.1.51038 gi|397780576|ref|YP_006545049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]