SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780767|ref|YP_006545240.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780767|ref|YP_006545240.1|
Domain Number 1 Region: 1-201,268-292
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.7e-65
Family Creatinase/aminopeptidase 0.00000552
Further Details:      
 
Domain Number 2 Region: 202-266
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000015
Family Methionine aminopeptidase, insert domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780767|ref|YP_006545240.1|
Sequence length 293
Comment methionyl aminopeptidase [Methanoculleus bourgensis MS2]
Sequence
MIMNDEVYDAYREAGALARKVLHRGAGLVKEGAGILEMVEETEAMVTDEGAILAFPLNVS
LNEAAAHDTAMPGDERMFAAGDLVKVDLGVQVDGYIADTALTVDLGDHAKLVEASRAALE
AAIAIVRPGITTGEIGAVIQATIEEHNYKPVANLTGHGLDRYDLHSAPTIPNIAMSGGAV
IEEGMVFAIEPFATTGSGRVTEAARVEIYQQIAARPARLPSAKRVLETARPRRGLPFSRR
WVPGDKVDIGLMNLVRSGILHPFPVLHDVPGSFVSQAEHTLVVTADGCEVTTR
Download sequence
Identical sequences A0A167S8J5 I7LMU3
gi|397780767|ref|YP_006545240.1| WP_014867498.1.51038 WP_014867498.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]